- Recombinant Lactococcus lactis subsp. cremoris Thiamine transporter ThiT (thiT)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1069982
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 19,909 Da
- E Coli or Yeast
- Thiamine transporter ThiT (thiT)
- 1-182
Sequence
MSNSKFNVRLLTEIAFMAALAFIISLIPNTVYGWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQAFLEYLVAPVSLGIAGLFRQKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQYAWKGWGAVAYSLAVNGISGILTAIAAFVILIIFVKKFPKLFIHSNY